DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Hsp27

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:140 Identity:43/140 - (30%)
Similarity:65/140 - (46%) Gaps:36/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALPSRIPKQQNYVSDISSPLIQDEGDNKVL 104
            |.:...|..|:|.|               |...|:.||:                :..:|    .
  Fly    61 ERSHGHHNQMSRRA---------------SGGPNALLPA----------------VGKDG----F 90

  Fly   105 KLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKD 168
            ::..||||:.|.|:.||.||..::|..||||:.|... :.|.:.|::.||||.:|..:.|::|.|
  Fly    91 QVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSD 155

  Fly   169 GVLTVDAPLP 178
            ||||:.||.|
  Fly   156 GVLTLKAPPP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 32/81 (40%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452099
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.