DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hspb1

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001008615.2 Gene:hspb1 / 368243 ZFINID:ZDB-GENE-030326-4 Length:199 Species:Danio rerio


Alignment Length:119 Identity:48/119 - (40%)
Similarity:70/119 - (58%) Gaps:8/119 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PSRIPKQQNYVS-DISSPL--IQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSD 138
            |...|.....:| .:||.:  ::..||:  .|:..||:.::|||:.|||.|..|.:..||||:.|
Zfish    74 PMMTPSYGRALSRQLSSGMSEVKQTGDS--WKISLDVNHFSPEELNVKTKDGVLEITGKHEERKD 136

  Fly   139 TKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPL--PALTAGETLIPI 189
            ... :.|.:.|::.||.||:.|.|.|.||.:|||||:|||  ||:.|.|..||:
Zfish   137 EHGFISRCFTRKYTLPPGVDSEKISSCLSPEGVLTVEAPLPKPAIQAPEVNIPV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 35/81 (43%)
hspb1NP_001008615.2 ACD_HspB1_like 91..176 CDD:107230 35/86 (41%)
IbpA <94..191 CDD:223149 43/99 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.