DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Hspb9

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001102305.1 Gene:Hspb9 / 363681 RGDID:1309122 Length:203 Species:Rattus norvegicus


Alignment Length:167 Identity:38/167 - (22%)
Similarity:74/167 - (44%) Gaps:26/167 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RKMEEEMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALPSRIPKQQNYVSDISSPLIQDE- 98
            |.:.:::    |..|.|..:.|    ||.:.....:...|..||....::|..:.:...|::|: 
  Rat    25 RALRQQL----HSRMQRVGSSF----STGQREPGENRVASRCPSVALSERNQAATLPVRLLKDDL 81

  Fly    99 -------GDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSD--TKSVYR---EYNREFL 151
                   .:....:::.|...:|||::||:...|.|:|..|.:::|:  ::..||   ..:|:..
  Rat    82 AAAHANGCEEPSFQMKLDAHGFAPEDLVVRIDGQNLMVTGKRQQESNDPSRGRYRLEQSVHRQMQ 146

  Fly   152 LPKGVNPESIRSSLSKDGVLTVDA-----PLPALTAG 183
            ||..::|.::..||:..|.|....     |||....|
  Rat   147 LPMTLDPAAMTCSLTPSGHLWFKGQNKCLPLPEAQTG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 22/98 (22%)
Hspb9NP_001102305.1 ACD_HspB9_like 87..172 CDD:107236 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.