DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Cryab

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_037067.1 Gene:Cryab / 25420 RGDID:2414 Length:175 Species:Rattus norvegicus


Alignment Length:126 Identity:45/126 - (35%)
Similarity:66/126 - (52%) Gaps:3/126 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 STTNSALP--SRIPKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAK 132
            ||..|..|  .|.|......|.|.:.|.:...:.....:..||..::|||:.||.:...:.||.|
  Rat    39 STATSLSPFYLRPPSFLRAPSWIDTGLSEMRMEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGK 103

  Fly   133 HEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLIPIAHK 192
            |||:.|... :.||::|::.:|..|:|.:|.||||.||||||:.|....:..|..|||..:
  Rat   104 HEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQASGPERTIPITRE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 31/81 (38%)
CryabNP_037067.1 Crystallin 1..52 CDD:395419 5/12 (42%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 32/82 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..175 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342810
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.