DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hsp16

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_596091.1 Gene:hsp16 / 2540977 PomBaseID:SPBC3E7.02c Length:143 Species:Schizosaccharomyces pombe


Alignment Length:122 Identity:25/122 - (20%)
Similarity:53/122 - (43%) Gaps:13/122 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAK--HEEKSD----- 138
            |:..|.:....||.|........:.:..::.....|::.|.....||.:..:  :|.|::     
pombe    25 PRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGN 89

  Fly   139 ---TKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLIPIAHK 192
               ::..:..::|...:|..::.:.|.::.| :|:|||  .||.:...:|...||.|
pombe    90 QRWSERRFGSFSRTITIPAKIDADRIEANFS-NGLLTV--TLPKVEKSQTKKQIAIK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 14/90 (16%)
hsp16NP_596091.1 IbpA 1..143 CDD:223149 24/120 (20%)
ACD_sHsps-like 40..130 CDD:107221 15/92 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.