DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Hspb6

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_620242.1 Gene:Hspb6 / 192245 RGDID:621554 Length:162 Species:Rattus norvegicus


Alignment Length:120 Identity:42/120 - (35%)
Similarity:62/120 - (51%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SALPSRIPKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSD 138
            |..|:.|.........::.|..|...|.....:..||..::||||.||.|...:.|||:|||:.|
  Rat    44 SLCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPD 108

  Fly   139 TKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLIPIAHK 192
            ... :.||::|.:.||.||:|.::.|:||.:|||::.| .||........|.|.|
  Rat   109 EHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQA-TPASAQASLPSPPAAK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 33/81 (41%)
Hspb6NP_620242.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 6/27 (22%)
Crystallin 3..58 CDD:395419 3/13 (23%)
ACD_HspB4-5-6 66..148 CDD:107233 33/82 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.