DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and ZK1128.7

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_499252.2 Gene:ZK1128.7 / 191528 WormBaseID:WBGene00014233 Length:205 Species:Caenorhabditis elegans


Alignment Length:70 Identity:22/70 - (31%)
Similarity:39/70 - (55%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LRFDVSQYAPEEIVVKTVDQKLLVHA-KHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDG 169
            :..||..:.||||.|...|..|.:.. :.|...|..::.|.::|::.:|..|:.::|||.|:..|
 Worm   106 IEIDVFHFMPEEIKVVLTDDTLSISGERFESTGDGHTLRRSFSRKYSIPDDVHLDTIRSHLTNSG 170

  Fly   170 VLTVD 174
            ||.::
 Worm   171 VLIIN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 22/70 (31%)
ZK1128.7NP_499252.2 metazoan_ACD 96..178 CDD:107247 22/70 (31%)

Return to query results.
Submit another query.