powered by:
Protein Alignment CG14207 and hsp-17
DIOPT Version :9
Sequence 1: | NP_728275.1 |
Gene: | CG14207 / 32955 |
FlyBaseID: | FBgn0031037 |
Length: | 192 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023957.1 |
Gene: | hsp-17 / 186113 |
WormBaseID: | WBGene00002021 |
Length: | 149 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 34/66 - (51%) |
Similarity: | 45/66 - (68%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 DVSQYAPEEIVVKTVDQKLLVHAKHEEKSDT-KSVYREYNREFLLPKGVNPESIRSSLSKDGVLT 172
||||:.|||:.|..||.:|::..||.||:|. ..|.|.:.|::.||.||.||.|:|.||.:||||
Worm 62 DVSQFEPEELKVNIVDNQLIIEGKHNEKTDKYGQVERHFVRKYNLPTGVRPEQIKSELSNNGVLT 126
Fly 173 V 173
|
Worm 127 V 127
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R6558 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.950 |
|
Return to query results.
Submit another query.