DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hsp-17

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001023957.1 Gene:hsp-17 / 186113 WormBaseID:WBGene00002021 Length:149 Species:Caenorhabditis elegans


Alignment Length:66 Identity:34/66 - (51%)
Similarity:45/66 - (68%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DVSQYAPEEIVVKTVDQKLLVHAKHEEKSDT-KSVYREYNREFLLPKGVNPESIRSSLSKDGVLT 172
            ||||:.|||:.|..||.:|::..||.||:|. ..|.|.:.|::.||.||.||.|:|.||.:||||
 Worm    62 DVSQFEPEELKVNIVDNQLIIEGKHNEKTDKYGQVERHFVRKYNLPTGVRPEQIKSELSNNGVLT 126

  Fly   173 V 173
            |
 Worm   127 V 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 34/66 (52%)
hsp-17NP_001023957.1 metazoan_ACD 49..128 CDD:107247 34/66 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.