DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and F08H9.4

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_506586.1 Gene:F08H9.4 / 184215 WormBaseID:WBGene00008592 Length:147 Species:Caenorhabditis elegans


Alignment Length:146 Identity:33/146 - (22%)
Similarity:61/146 - (41%) Gaps:33/146 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DSEMRKMEEEMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALPSRIPKQQNYVSDISSPLI 95
            ||::.:|..:|...:..||.....|       ...|..|...||                     
 Worm    12 DSQLGEMMRDMGGMQRRLMPISGTF-------NPMTDDSEIMNS--------------------- 48

  Fly    96 QDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPES 160
                 |....:..:||.:.|||:.|....::|.:..:|:.:::..:..:.::|..|||:.|:..|
 Worm    49 -----NDKFAVNLNVSNFKPEELKVNLEGRQLSIQGEHDVENEHGASRKSFSRMILLPEDVDITS 108

  Fly   161 IRSSLSKDGVLTVDAP 176
            :.::||.||.|.::||
 Worm   109 VATNLSNDGKLCIEAP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 22/81 (27%)
F08H9.4NP_506586.1 metazoan_ACD 47..125 CDD:107247 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.