DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hsp-25

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:202 Identity:94/202 - (46%)
Similarity:130/202 - (64%) Gaps:24/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EANKRNIPIKLGDFSVIDTEFSNIRERFDSEMRKMEEEMAKFRHE-------------LMNREAN 54
            |.::|.|.:...::||||.||.|:|:||:.|||::||||.:.|.|             :.|:..|
 Worm    14 EMSERRIDVNRSNYSVIDNEFGNMRDRFEQEMRRVEEEMKRLRSEFEGYRPNGGPPAAISNQPYN 78

  Fly    55 FFESTSSTKKTTTTSSTTNSALP-----------SRIPKQQNYVSDISSPLIQDEGDNKVLKLRF 108
            .:.:|||..:|:..:....|.||           :..|....|:.::.||||:||.|.|.|:|||
 Worm    79 AYSNTSSHHETSNRTGGFGSPLPPPSFHGPSDLMAHRPTYDPYLDNLKSPLIKDESDGKTLRLRF 143

  Fly   109 DVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTV 173
            ||:.|.|||:.|||:|.:||||||||||:..::|:||||:|||||:|.|||.|.|:||.||||||
 Worm   144 DVANYKPEEVTVKTIDNRLLVHAKHEEKTPQRTVFREYNQEFLLPRGTNPEQISSTLSTDGVLTV 208

  Fly   174 DAPLPAL 180
            :||||.|
 Worm   209 EAPLPQL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 53/80 (66%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 53/80 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156366
Domainoid 1 1.000 116 1.000 Domainoid score I3734
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15130
Inparanoid 1 1.050 183 1.000 Inparanoid score I2630
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28695
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0016657
OrthoInspector 1 1.000 - - oto20404
orthoMCL 1 0.900 - - OOG6_112259
Panther 1 1.100 - - LDO PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X13523
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.