DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hsp-16.41

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_872116.2 Gene:hsp-16.41 / 178660 WormBaseID:WBGene00002018 Length:143 Species:Caenorhabditis elegans


Alignment Length:102 Identity:29/102 - (28%)
Similarity:53/102 - (51%) Gaps:5/102 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLL 152
            ||....::.||..   ..::.|||.:.||.:.:|...::|.:....|.||:...:.|.:::..||
 Worm    41 SDNIGEIVNDESK---FSVQLDVSHFKPENLKIKLDGRELKIEGIQETKSEHGYLKRSFSKMILL 102

  Fly   153 PKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLIPI 189
            |:..:..|::|::|.:|.|.::|  |..|.....|||
 Worm   103 PEDADLPSVKSAISNEGKLQIEA--PKKTNSSRSIPI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 22/80 (28%)
hsp-16.41NP_872116.2 metazoan_ACD 46..127 CDD:107247 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.