DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Cryab

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001276711.1 Gene:Cryab / 12955 MGIID:88516 Length:175 Species:Mus musculus


Alignment Length:132 Identity:49/132 - (37%)
Similarity:72/132 - (54%) Gaps:15/132 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 STTNSALP--SRIPKQQNYVSDISSPLIQDEG--DNKVLKLRF----DVSQYAPEEIVVKTVDQK 126
            ||..|..|  .|.|      |.:.:|...|.|  :.::.|.||    ||..::|||:.||.:...
Mouse    39 STATSLSPFYLRPP------SFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDV 97

  Fly   127 LLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLIPIA 190
            :.||.||||:.|... :.||::|::.:|..|:|.:|.||||.||||||:.|...::..|..|||.
Mouse    98 IEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPIT 162

  Fly   191 HK 192
            .:
Mouse   163 RE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 36/87 (41%)
CryabNP_001276711.1 Crystallin 1..52 CDD:395419 5/12 (42%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 35/82 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..175 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839006
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.