DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hspb6

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:129 Identity:46/129 - (35%)
Similarity:68/129 - (52%) Gaps:14/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ALPSRIPKQQNYVSDISSPLIQDEG------DNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKH 133
            |:|..:.....|....|.|...:.|      |.....:..||..::|||:.||.|...:.|||||
 Frog    41 AMPMPMALSPYYYRSPSIPQPSEAGLSEVKLDKDQFSVLLDVKHFSPEELTVKVVGDYVEVHAKH 105

  Fly   134 EEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAG----ETLIPIAHK 192
            ||:.|... :.||::|.:.:|..|:|.:|.|:||.:|:|::.||   :|||    |..||||.|
 Frog   106 EERPDEHGFISREFHRRYKIPPTVSPAAISSALSAEGLLSIQAP---VTAGGKQEERSIPIARK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 31/87 (36%)
hspb6XP_002940672.2 Crystallin 1..56 CDD:366148 3/14 (21%)
ACD_HspB4-5-6 68..149 CDD:107233 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.