DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hsp30e

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_002944275.2 Gene:hsp30e / 100493795 XenbaseID:XB-GENE-5755528 Length:215 Species:Xenopus tropicalis


Alignment Length:187 Identity:57/187 - (30%)
Similarity:89/187 - (47%) Gaps:40/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KLGDFSVIDTEFSNIRERFDSEMRKMEEEMAKFRHELMNREANFFESTSSTK--KTTTTSSTTNS 74
            :|||      ...::|...:..|:.:.|     .:.|::::.:....|..::  :.|.|..|   
 Frog    34 QLGD------GILSMRNDMERRMQCVNE-----AYRLLSQDMDMRRITDQSRQPRATETEGT--- 84

  Fly    75 ALPSRIPKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDT 139
                             ||....:|.:. .:|..||..::|.|:.|||..::::|..|||.|||:
 Frog    85 -----------------SPSSGKDGKDH-FELTLDVRDFSPHELTVKTQGRRVIVTGKHERKSDS 131

  Fly   140 KS-----VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPAL-TAGETLIPIA 190
            :.     .|||:.||..||:|||||.:..||||||.|.:.||..|| .|.|..|||:
 Frog   132 EDGSYVHEYREWKREAELPEGVNPEQVVCSLSKDGHLHIQAPRLALPPASERPIPIS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 36/85 (42%)
hsp30eXP_002944275.2 ACD_HspB9_like 88..174 CDD:107236 36/86 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.