DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and LOC100491399

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_002939080.1 Gene:LOC100491399 / 100491399 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:166 Identity:42/166 - (25%)
Similarity:68/166 - (40%) Gaps:38/166 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FSVIDTEFSNIRERFDSEMRKMEEEMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALPSRI 80
            ||.::.|.....|:..|....||:    |..:|:.      |.|....||          ||   
 Frog    30 FSDLEQEMIRTVEKIKSSFDLMEQ----FHQKLLQ------EVTVQQNKT----------LP--- 71

  Fly    81 PKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEK-SDTKSVY- 143
                  |.:.|.....|:|    ..|...|..::|||:.||.:.:||||....|.| :|.|..: 
 Frog    72 ------VLNGSDAKATDKG----FTLCLGVEDFSPEELTVKLLGRKLLVTGAKESKCNDGKGSFS 126

  Fly   144 ---REYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 176
               :.:.:|..||..|..:.:..:::.:|.|.::||
 Frog   127 YKCQIFRKEADLPMNVREDKLSCTMTAEGKLLIEAP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 25/86 (29%)
LOC100491399XP_002939080.1 alpha-crystallin-Hsps_p23-like 84..163 CDD:381838 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.