DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and cryaa

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_031752202.1 Gene:cryaa / 100488185 XenbaseID:XB-GENE-5940571 Length:115 Species:Xenopus tropicalis


Alignment Length:85 Identity:28/85 - (32%)
Similarity:48/85 - (56%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGV 156
            |.::.:.|...:.|  ||..::||::.||..|..:.:|.||.|:.|... :.||::|.:.||..|
 Frog     6 PQVRSDRDRFFINL--DVKHFSPEDLSVKLHDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNV 68

  Fly   157 NPESIRSSLSKDGVLTVDAP 176
            :..|:..:||.||:|:...|
 Frog    69 DQNSVSCTLSADGILSFSGP 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 27/82 (33%)
cryaaXP_031752202.1 alpha-crystallin-Hsps_p23-like 5..89 CDD:412199 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.