DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and cryaa

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_031752202.1 Gene:cryaa / 100488185 XenbaseID:XB-GENE-5940571 Length:115 Species:Xenopus tropicalis


Alignment Length:85 Identity:28/85 - (32%)
Similarity:48/85 - (56%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGV 156
            |.::.:.|...:.|  ||..::||::.||..|..:.:|.||.|:.|... :.||::|.:.||..|
 Frog     6 PQVRSDRDRFFINL--DVKHFSPEDLSVKLHDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNV 68

  Fly   157 NPESIRSSLSKDGVLTVDAP 176
            :..|:..:||.||:|:...|
 Frog    69 DQNSVSCTLSADGILSFSGP 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 27/82 (33%)
cryaaXP_031752202.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 5..89 CDD:469641 28/85 (33%)

Return to query results.
Submit another query.