DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and si:dkey-1k23.3

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:87 Identity:35/87 - (40%)
Similarity:55/87 - (63%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKD 168
            |:..||:.:||.||.||.....|.:..||||:.|... :.|.:.|::.||.|:..|::::|||.|
Zfish   100 KISLDVNHFAPAEISVKIQHGFLEIAGKHEERQDGHGFIARSFTRKYNLPGGIEVENLQTSLSAD 164

  Fly   169 GVLTVDAPLPAL-TAGETLIPI 189
            |:|||:||.|:: ...:.:|||
Zfish   165 GILTVEAPFPSIPLPADVIIPI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 30/72 (42%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 88..172 CDD:469641 29/71 (41%)

Return to query results.
Submit another query.