DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and si:dkey-1k23.3

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:87 Identity:35/87 - (40%)
Similarity:55/87 - (63%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKD 168
            |:..||:.:||.||.||.....|.:..||||:.|... :.|.:.|::.||.|:..|::::|||.|
Zfish   100 KISLDVNHFAPAEISVKIQHGFLEIAGKHEERQDGHGFIARSFTRKYNLPGGIEVENLQTSLSAD 164

  Fly   169 GVLTVDAPLPAL-TAGETLIPI 189
            |:|||:||.|:: ...:.:|||
Zfish   165 GILTVEAPFPSIPLPADVIIPI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 30/72 (42%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin-Hsps_p23-like 88..172 CDD:320797 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.