DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and SDS3

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_012182.1 Gene:SDS3 / 854725 SGDID:S000001346 Length:327 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:61/256 - (23%)
Similarity:96/256 - (37%) Gaps:77/256 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NGTSNSNNMGTN--SELKEQMYQHKLFNLQKQMEELGQLVHPEYLKRVKKLDSQLK---ERRRMN 105
            |..|..|.:..|  || ::..|:.:|..||..:..|.|..:.:|.::|:.|:.:..   .|.|:.
Yeast    20 NIESKVNKIYQNFYSE-RDNQYKDRLTALQTDLTSLHQGDNGQYARQVRDLEEERDLELVRLRLF 83

  Fly   106 EVYKEYMRECVERDYVLEKMAAQKEYDEKMMDL-KDNLISDFEDRKRQIENERFSIELTN----- 164
            |.|: ..|..:|....:||..|:   .||::.| |:.|.|..|.:.::::.||..:::.|     
Yeast    84 EEYR-VSRSGIEFQEDIEKAKAE---HEKLIKLCKERLYSSIEQKIKKLQEERLLMDVANVHSYA 144

  Fly   165 -----------------------------DSMEIKTTIT------RKLRRRPNEPLPVIEKRRKP 194
                                         |:.....|.|      |.||||         ...|.
Yeast   145 MNYSRPQYQKNTRSHTVSGWDSSSNEYGRDTANESATDTGAGNDRRTLRRR---------NASKD 200

  Fly   195 ATGQLLVYQLDDKEIESDLKIIQRGRPNPVPQQNGSGSYGSGSQQQQSMHVLAEPTSNSGL 255
            ..|.      ::.:.|||   .|.|        |||||.|.||:|..........|..||:
Yeast   201 TRGN------NNNQDESD---FQTG--------NGSGSNGHGSRQGSQFPHFNNLTYKSGM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 31/150 (21%)
SDS3NP_012182.1 Sds3 21..310 CDD:400770 60/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.