DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and DEP1

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_009389.3 Gene:DEP1 / 851220 SGDID:S000000011 Length:405 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:51/277 - (18%)
Similarity:103/277 - (37%) Gaps:91/277 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QADTYDDESIGDERSEEDTDDASETEFRSP-------------SRYGAMNGTSNSNNMGTNSELK 61
            |.|..|:|   :|.:|||.:  :|.|..:|             .|..|:...::...  ..::|:
Yeast   140 QGDEGDNE---EENNEEDNE--NENEHTAPPALVMPSPIEMEEQRMTALKEITDIEY--KFAQLR 197

  Fly    62 EQMYQHKLFNLQKQMEELGQLVHPE---YLKRVKKLDSQLKERRRMNEVYKEYMRE-----CVER 118
            :::|.::|..||.:::...:..|||   |..::..:        |..::::.|.|:     |:..
Yeast   198 QKLYDNQLVRLQTELQMCLEGSHPELQVYYSKIAAI--------RDYKLHRAYQRQKYELSCINT 254

  Fly   119 DYVLEKMAAQKEYDEKMMDLKDNLIS-------DFEDRKRQIE------NERFSIELTNDSMEIK 170
            :.:..:....:::.:|:.||:..|::       |....:|.::      |....|:|.|.::...
Yeast   255 ETIATRTFIHQDFHKKVTDLRARLLNRTTQTWYDINKERRDMDIVIPDVNYHVPIKLDNKTLSCI 319

  Fly   171 T----------------------TITRKLRRRPNEPLPVIEKRRK------------------PA 195
            |                      :|..:.|..|.:.|.||..|.:                  |.
Yeast   320 TGYASAAQLCYPGEPVAEDLACESIEYRYRANPVDKLEVIVDRMRLNNEISDLEGLRKYFHSFPG 384

  Fly   196 TGQLLVYQLDDKEIESD 212
            ..:|  ..|.|.||..|
Yeast   385 APEL--NPLRDSEINDD 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 23/133 (17%)
DEP1NP_009389.3 Sds3 182..402 CDD:400770 39/230 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.