DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and brms1

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_956391.1 Gene:brms1 / 791681 ZFINID:ZDB-GENE-030616-596 Length:271 Species:Danio rerio


Alignment Length:226 Identity:52/226 - (23%)
Similarity:111/226 - (49%) Gaps:24/226 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ESIGDER-----------SEEDTDDASETEFRSPSRYGAMNGTSNSNNMGTNSELKEQMYQHKLF 70
            |..||||           .||:.:::||.:.....|..:......|:......|||::::|.:|.
Zfish    45 EESGDERDSDLEESEPEEEEEEEEESSEMDDEDCERRRSQCLDEMSDLEKQFLELKDKLFQERLN 109

  Fly    71 NLQKQMEELGQLVHPEYLKRVKKLDSQLKERRRMNEVYKEYMRECVERDYVLEKMAAQKEYDEKM 135
            .::.:::|:......||.:.:..|...|::|.::..||:|...:.|...:..|...|::..:.:.
Zfish   110 QVKLKLDEVLTGKAGEYREPLATLQQNLQQRTQVAGVYRELCLQVVRHKHECEVQGARQHLESEK 174

  Fly   136 MDLKDNLISDFEDRKRQIENERFSIELT----NDSMEIKTTITRKLRRRPNEPLPVIEKRRKPA- 195
            ..|.|.:.::..::.|::|.::.||::|    ||.:::|     |.:||.:  |...::::|.| 
Zfish   175 TLLFDAMKTELLEKIRRLEEDKQSIDITSEWWNDEVKMK-----KCKRRSH--LIRSDRKKKAAL 232

  Fly   196 -TGQLLVYQLDDKEIESDLKIIQRGRPNPVP 225
             :|..:||.|.:.:|..|...|::.:...:|
Zfish   233 VSGPYIVYMLRETDILEDWTAIKKAKAALMP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 26/116 (22%)
brms1NP_956391.1 Sds3 85..253 CDD:285764 40/174 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.