DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and brms1lb

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_003200736.1 Gene:brms1lb / 562889 ZFINID:ZDB-GENE-081031-54 Length:323 Species:Danio rerio


Alignment Length:324 Identity:90/324 - (27%)
Similarity:165/324 - (50%) Gaps:34/324 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QADTYDDE-SIGDERSEE-DTDDASETEFRSPSRYGAMNGTSNSNNMGTNSELKEQMYQHKLFNL 72
            :|.:.|:| |:....||: ||.|..:.:... .|...::..:|.....|  :||:.:|:.::..:
Zfish    24 EASSSDEEDSVSSTASEDGDTSDMDDEDCER-RRMECLDEMTNLEKQFT--DLKDHLYKERVTQM 85

  Fly    73 QKQMEELGQLVHPEYLKRVKKLDSQLKERRRMNEVYKEYMRECVERDYVLEKMAAQKEYDEKMMD 137
            ..:::|:......|||:.:..|...::.|.::..:|:|...|.|...|..|..||.:.::.:.:.
Zfish    86 DLKLQEVMAGSAAEYLEPLATLQENMQIRTKVAGIYRELCLESVRNKYECEMQAASQHWESEKLL 150

  Fly   138 LKDNLISDFEDRKRQIENERFSIELT----NDSMEIKTTITRKLRRRPNEPLPVIEKRRKP--AT 196
            |.|.:.|:.|::.|::|.:|.||::|    ||.::     :||.:::  :||.. .|::||  .:
Zfish   151 LFDTVQSELEEKIRRLEEDRHSIDITSELWNDGLQ-----SRKNKKK--DPLSP-GKKKKPVVVS 207

  Fly   197 GQLLVYQLDDKEIESDLKIIQRGRPNPVPQQNGSGSYGSGSQQQQSMHVLAEPTSNSGLVETRIE 261
            |..:||.|.|.:|..|...|::...:..|.:    .....|.:.:..|.:|           |.|
Zfish   208 GPYIVYMLQDLDILEDWTAIRKAMASMGPHR----VKADASLKAEKHHHVA-----------RSE 257

  Fly   262 DNKLLYERRWFCRGQQVYVEGKEMSKFAATITAIGNEVVWVKRTNETKVKINMSHLAKGKISIK 325
            :.:|.|:.:||.|||.:.:..|:....:||||.|.::.||.||.:.:|.||.:|.|.|||.|||
Zfish   258 EGRLFYDNKWFSRGQAICINRKDEFPTSATITTINHDEVWYKRLDGSKSKIYISQLQKGKYSIK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 29/116 (25%)
brms1lbXP_003200736.1 Sds3 59..>175 CDD:285764 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.