DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and Brms1l

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001032845.1 Gene:Brms1l / 52592 MGIID:1196337 Length:323 Species:Mus musculus


Alignment Length:335 Identity:91/335 - (27%)
Similarity:162/335 - (48%) Gaps:49/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LQADTYDDESIGDERSEEDTDDASETEFRSPS----------RYGAMNGTSNSNNMGTNSELKEQ 63
            ::.|..::|  |....:|||:.:|.:|....|          |...::..||.....|  :||:|
Mouse    18 MEVDYAENE--GSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFT--DLKDQ 78

  Fly    64 MYQHKLFNLQKQMEELGQLVHPEYLKRVKKLDSQLKERRRMNEVYKEYMRECVERDYVLEKMAAQ 128
            :|:.:|..:..:::|:.....||||:.:..|...::.|.::..:|:|...|.|:..|..|..|::
Mouse    79 LYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASR 143

  Fly   129 KEYDEKMMDLKDNLISDFEDRKRQIENERFSIELT----NDSMEIKTTITRKLRRRPNEPLPVIE 189
            :..:.:.:.|.|.:.|:.|::.|::|.:|.||::|    ||.::     :||.|:.|..|     
Mouse   144 QHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQ-----SRKKRKDPFSP----- 198

  Fly   190 KRRKP--ATGQLLVYQLDDKEIESDLKIIQRGRPNPVPQQNGSGSYGSGSQQQQSMHVLAEP--T 250
            .::||  .:|..:||.|.|.:|..|...|::......|.:                 |..||  .
Mouse   199 DKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHR-----------------VKTEPPVK 246

  Fly   251 SNSGLVETRIEDNKLLYERRWFCRGQQVYVEGKEMSKFAATITAIGNEVVWVKRTNETKVKINMS 315
            ....|...|.|:.:|.|:..|:.|||.:.::.|:....:|.||.|.::.||.||.:.:|.|:.:|
Mouse   247 LEKHLHSARSEEGRLYYDGEWYIRGQTICIDRKDECPTSAVITTINHDEVWFKRPDGSKSKLYIS 311

  Fly   316 HLAKGKISIK 325
            .|.|||.|||
Mouse   312 QLQKGKYSIK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 31/116 (27%)
Brms1lNP_001032845.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 9/39 (23%)
Sds3 61..>179 CDD:312195 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.