DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and Brms1

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_572840.1 Gene:Brms1 / 32243 FlyBaseID:FBgn0030434 Length:259 Species:Drosophila melanogaster


Alignment Length:255 Identity:66/255 - (25%)
Similarity:122/255 - (47%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DTYDDESIGDERSEEDTDDASETEFRSPSRYGAMNGTSNSNNMGTNSELKEQMYQHKLFNLQKQM 76
            ||.|:|    |.:|.|:||:||.:.....|..|.:.....:.....:||:||.|..::..:::|:
  Fly    29 DTSDEE----EANECDSDDSSELDASEIDRRRAEHIEDLLSLERQFNELREQYYVERINLIERQL 89

  Fly    77 EELGQLVHPEYLKRVKKLDSQLKERRRMNEVYKEYMRECVERDYVLEKMAAQKEYD-EKMMDLKD 140
            .|:......|:::..|:||.:.:.|..:.:|.::|..:.:|..|..|:.||.:.:: ||.|.| |
  Fly    90 AEVRSGRSEEFVQPQKELDKKYRTRIEVADVLRKYRLQNIEHKYQSEEQAAVQHFESEKHMAL-D 153

  Fly   141 NLISDFEDRKRQIENERFSIELT-----NDSMEIKTTITRKLRRRPNEPLPVIEKRRKPATGQLL 200
            ||..:|.:|.|::|.:|.:::::     .|..:.|.       |.|.      .|:....||..:
  Fly   154 NLREEFMERIRRLEEDRHNVDISWADWGTDKRQSKV-------RGPG------RKKAVTVTGPYV 205

  Fly   201 VYQLDDKEIESDLKIIQRGRPNPVPQQNGSGSYGSGSQQQQSMHVLAEPTSN-----SGL 255
            ||.|.:::|..|..||::..     :::.|.:..:|:         ..|||.     |||
  Fly   206 VYMLREEDIMEDWTIIRKAL-----KRSSSSATAAGT---------VTPTSGVSVSLSGL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 32/118 (27%)
Brms1NP_572840.1 Sds3 59..>176 CDD:285764 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443429
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21964
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.