DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and Brms1

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001009605.1 Gene:Brms1 / 293668 RGDID:1311057 Length:246 Species:Rattus norvegicus


Alignment Length:220 Identity:54/220 - (24%)
Similarity:109/220 - (49%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DESIGDERSEEDTDDASETEFRSPSRYGAMNGTSNSNNMGTN---SELKEQMYQHKLFNLQKQME 77
            ||| .:|||...|:...|:.......|........|..:...   |||||::::.:|..|:.::|
  Rat    28 DES-EEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLE 91

  Fly    78 ELGQLVHPEYLKRVKKLDSQLKERRRMNEVYKEYMRECVERDYVLEKMAAQKEYDEKMMDLKDNL 142
            |:|....|||.:.:..|...||.|.::..:||.:..:.:...|..|...|::..:.:.:.|.|.|
  Rat    92 EVGAERAPEYTEPLGGLQQSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKLLLYDTL 156

  Fly   143 ISDFEDRKRQIENERFSIELTNDSMEIKTTITRKLRRRPN----EPLPVIEKRRKP-ATGQLLVY 202
            :.:.::|.:::|.:|.|::::::..:      .||..|.:    :.:|..::::.| .:|..:||
  Rat   157 LGELQERIQRLEEDRQSLDISSEWWD------DKLHSRGSSKTWDSVPPSKRKKAPLVSGPYIVY 215

  Fly   203 QLDDKEIESDLKIIQRGRPNPVPQQ 227
            .|.:.:|..|...|::.|....||:
  Rat   216 MLQEIDILEDWTAIKKARAAVSPQK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 29/112 (26%)
Brms1NP_001009605.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 9/29 (31%)
Sds3 60..>177 CDD:400770 30/116 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.