DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and BRMS1

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_024304193.1 Gene:BRMS1 / 25855 HGNCID:17262 Length:304 Species:Homo sapiens


Alignment Length:284 Identity:64/284 - (22%)
Similarity:126/284 - (44%) Gaps:37/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DTYDDESIGDERSEEDTDDASETEFRSPSRYGAMNGTSNSNNMGTN-----------------SE 59
            ||.:.|:.||..:|.:.::....|.||.|:..:...:|..::....                 ||
Human     9 DTEEMEAEGDSAAEMNGEEEESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQFSE 73

  Fly    60 LKEQMYQHKLFNLQKQMEELGQLVHPEYLKRVKKLDSQLKERRRMNEVYKEYMRECVERDYVLEK 124
            |||::::.:|..|:.::||:|....|||.:.:..|...||.|.::..:||.:..:.:...|..|.
Human    74 LKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQRSLKIRIQVAGIYKGFCLDVIRNKYECEL 138

  Fly   125 MAAQKEYDEKMMDLKDNLISDFEDRKRQIENERFSIELTNDSMEIKTTITRKLRRRPNEPLPVIE 189
            ..|::..:.:.:.|.|.|..:.::|.:::|.:|.|::|:::..:.|  :..:...|..:.||..:
Human   139 QGAKQHLESEKLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDK--LHARGSSRSWDSLPPSK 201

  Fly   190 KRRKP-ATGQLLVYQLDDKEIESDLKIIQRGRPNPVPQQNGSGSYGSGSQQQQSMHVLAE----P 249
            :::.| .:|..:||.|.:.:|..|...|::.....|..|         ...|.|.|...:    |
Human   202 RKKAPLVSGPYIVYMLQEIDILEDWTAIKKDLDPAVHSQ---------GDPQSSWHCTQDSRLPP 257

  Fly   250 TSNSGLVETRIEDNKLLYERRWFC 273
            .........|:...:||    |.|
Human   258 ADRRTHRPLRVCPARLL----WCC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 30/112 (27%)
BRMS1XP_024304193.1 Sds3 60..>178 CDD:312195 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.