DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14220 and Brms1

DIOPT Version :9

Sequence 1:NP_001245759.1 Gene:CG14220 / 32954 FlyBaseID:FBgn0031036 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001360976.1 Gene:Brms1 / 107392 MGIID:2388804 Length:246 Species:Mus musculus


Alignment Length:216 Identity:53/216 - (24%)
Similarity:109/216 - (50%) Gaps:7/216 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DESIGDERSEEDTDDASETEFRSPSRYGAMNGTSNSNNMGTN---SELKEQMYQHKLFNLQKQME 77
            ||| .:|||...|:...|:.......|........|..:...   |||||::::.:|..|:.::|
Mouse    28 DES-EEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLE 91

  Fly    78 ELGQLVHPEYLKRVKKLDSQLKERRRMNEVYKEYMRECVERDYVLEKMAAQKEYDEKMMDLKDNL 142
            |:|....|||.:.:..|...||.|.::..:||.:..:.:...|..|...|::..:.:.|.|.|.|
Mouse    92 EVGAERAPEYTEPLGGLQQSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKMLLYDTL 156

  Fly   143 ISDFEDRKRQIENERFSIELTNDSMEIKTTITRKLRRRPNEPLPVIEKRRKP-ATGQLLVYQLDD 206
            :.:.::|.:::|.:|.|::::::..:.|  :..:...:..:.:|..::::.| .:|..:||.|.:
Mouse   157 LGELQERIQRLEEDRQSLDISSEWWDDK--LHSRSSSKAGDAMPPSKRKKAPLVSGPYIVYMLQE 219

  Fly   207 KEIESDLKIIQRGRPNPVPQQ 227
            .:|..|...|::.|....||:
Mouse   220 IDILEDWTAIKKARAAVSPQK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14220NP_001245759.1 Sds3 58..>171 CDD:285764 30/112 (27%)
Brms1NP_001360976.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 9/29 (31%)
Sds3 60..>178 CDD:369987 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1456563at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.