DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10b and RPS10B

DIOPT Version :9

Sequence 1:NP_001245758.1 Gene:RpS10b / 32953 FlyBaseID:FBgn0285947 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_013957.1 Gene:RPS10B / 855270 SGDID:S000004843 Length:105 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:57/104 - (54%)
Similarity:75/104 - (72%) Gaps:8/104 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQFAWRHY 65
            |.|||..|..|::|||:|||:||||||:..||.|::: .||:||||:|||.|:|.||.||:|::|
Yeast     1 MLMPKQERNKIHQYLFQEGVVVAKKDFNQAKHEEIDT-KNLYVIKALQSLTSKGYVKTQFSWQYY 64

  Fly    66 YWYLTNEGIEELRSYLHLPPEIVPSTL-------KRPAR 97
            |:.||.||:|.||.||:||..|||.|.       :||.|
Yeast    65 YYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPSQRPQR 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10bNP_001245758.1 S10_plectin 3..96 CDD:281497 54/99 (55%)
RPS10BNP_013957.1 COG5045 1..105 CDD:227378 57/104 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343004
Domainoid 1 1.000 111 1.000 Domainoid score I1374
eggNOG 1 0.900 - - E1_COG5045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1339
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53709
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - mtm9185
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - LDO PTHR12146
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X688
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.