DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10b and RPS10B

DIOPT Version :9

Sequence 1:NP_001245758.1 Gene:RpS10b / 32953 FlyBaseID:FBgn0285947 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_198967.1 Gene:RPS10B / 834154 AraportID:AT5G41520 Length:180 Species:Arabidopsis thaliana


Alignment Length:177 Identity:89/177 - (50%)
Similarity:109/177 - (61%) Gaps:29/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQFAWRHY 65
            |.:.:.:|..|.:|||||||:.|||||:..:||.:||:|||.|||.|||..|:..|:|.|||.||
plant     1 MIISETNRREISKYLFKEGVLFAKKDFNLPQHPLIESVPNLQVIKLMQSFKSKEYVRETFAWMHY 65

  Fly    66 YWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRP--RPAVGG---PRGP--GDASKTGEDR 123
            ||:||||||:.||:||:||.||||:|||:..     :|  ||..||   ||||  ||..:...||
plant    66 YWFLTNEGIDFLRTYLNLPSEIVPATLKKQQ-----KPLGRPFGGGGDRPRGPPRGDGERRFGDR 125

  Fly   124 SAYRRAP--GGSGVDKKG---DVGPGAGEVEFRG-------GFGRGS 158
            ..||..|  ||...||.|   |..||     |||       |||||:
plant   126 DGYRGGPKSGGEYGDKAGAPADYQPG-----FRGGAGGARQGFGRGA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10bNP_001245758.1 S10_plectin 3..96 CDD:281497 56/92 (61%)
RPS10BNP_198967.1 S10_plectin 3..95 CDD:397530 56/91 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 122 1.000 Domainoid score I1845
eggNOG 1 0.900 - - E1_COG5045
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134225
Inparanoid 1 1.050 148 1.000 Inparanoid score I1727
OMA 1 1.010 - - QHG53709
OrthoDB 1 1.010 - - D1588066at2759
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - mtm1126
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - O PTHR12146
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X688
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.