DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10b and AT4G25740

DIOPT Version :9

Sequence 1:NP_001245758.1 Gene:RpS10b / 32953 FlyBaseID:FBgn0285947 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_194304.1 Gene:AT4G25740 / 828679 AraportID:AT4G25740 Length:177 Species:Arabidopsis thaliana


Alignment Length:174 Identity:86/174 - (49%)
Similarity:107/174 - (61%) Gaps:27/174 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQFAWRHY 65
            |.:.:.:|..|.:|||||||..|||||:..||| |..:|||.|||.|||..|:..|:|.|||.||
plant     1 MIISENNRREICKYLFKEGVCFAKKDFNLPKHP-LIDVPNLQVIKLMQSFKSKEYVRETFAWMHY 64

  Fly    66 YWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRP--RPAVGGP-----RGP----GDASKT 119
            ||:|||||||.||:||:||.::||:|||:.|     :|  || .|||     |||    ||..:.
plant    65 YWFLTNEGIEFLRTYLNLPSDVVPATLKKSA-----KPGGRP-FGGPPGDRQRGPPRSDGDRPRF 123

  Fly   120 GEDRSAYRRAPGGSGVDKKGDVGPGAGEVEFRG-----GFGRGS 158
            | ||..||..|.|.  |:||. .|...:..|:|     |||||:
plant   124 G-DRDGYRGGPRGG--DEKGG-APADFQPSFQGGGGRPGFGRGA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10bNP_001245758.1 S10_plectin 3..96 CDD:281497 55/92 (60%)
AT4G25740NP_194304.1 S10_plectin 3..94 CDD:397530 55/91 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 122 1.000 Domainoid score I1845
eggNOG 1 0.900 - - E1_COG5045
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134225
Inparanoid 1 1.050 148 1.000 Inparanoid score I1727
OMA 1 1.010 - - QHG53709
OrthoDB 1 1.010 - - D1588066at2759
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - mtm1126
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - O PTHR12146
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X688
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.