DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10b and Rps10

DIOPT Version :9

Sequence 1:NP_001245758.1 Gene:RpS10b / 32953 FlyBaseID:FBgn0285947 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_080239.1 Gene:Rps10 / 67097 MGIID:1914347 Length:165 Species:Mus musculus


Alignment Length:162 Identity:108/162 - (66%)
Similarity:123/162 - (75%) Gaps:8/162 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPEL--ESIPNLHVIKAMQSLHSRGLVKEQFAWR 63
            |.|||.:|:||||.||||||:|||||.|..|||||  :::|||||:||||||.|||.||||||||
Mouse     1 MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWR 65

  Fly    64 HYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAVGGPRGPGDASKT-GE-DRSAY 126
            |:|||||||||:.||.||||||||||:||:| :|.||.||||.  ||.|...|..| || ||..|
Mouse    66 HFYWYLTNEGIQYLRDYLHLPPEIVPATLRR-SRPETGRPRPK--GPEGERPARFTRGEADRDTY 127

  Fly   127 RRAPGGSGVDKKGDVGPG-AGEVEFRGGFGRG 157
            ||:....|.|||.:.|.| |.|.:||||||||
Mouse   128 RRSAVPPGADKKAEAGAGSATEFQFRGGFGRG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10bNP_001245758.1 S10_plectin 3..96 CDD:281497 72/94 (77%)
Rps10NP_080239.1 S10_plectin 3..97 CDD:397530 72/94 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..165 40/73 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4242
eggNOG 1 0.900 - - E1_COG5045
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3758
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53709
OrthoDB 1 1.010 - - D1588066at2759
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - otm42687
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - LDO PTHR12146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1228
SonicParanoid 1 1.000 - - X688
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.