DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10b and rps10

DIOPT Version :9

Sequence 1:NP_001245758.1 Gene:RpS10b / 32953 FlyBaseID:FBgn0285947 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001016718.1 Gene:rps10 / 549472 XenbaseID:XB-GENE-969777 Length:165 Species:Xenopus tropicalis


Alignment Length:161 Identity:104/161 - (64%)
Similarity:121/161 - (75%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPEL--ESIPNLHVIKAMQSLHSRGLVKEQFAWR 63
            |.|||..|:||||.||||||:|||||.|..|||||  :::|||||:||||||.|||.||||||||
 Frog     1 MLMPKKDRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWR 65

  Fly    64 HYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRP-AVGGPRGPGDASKTGEDRSAYR 127
            |:|||||||||:.||.:|||||||||:||:| :|.||.|||| .:.|.| |...|:...||..||
 Frog    66 HFYWYLTNEGIQYLRDFLHLPPEIVPATLRR-SRPETGRPRPKGLEGER-PARLSRGETDRDTYR 128

  Fly   128 RAPGGSGVDKKGDVGPGAG-EVEFRGGFGRG 157
            |:....|.|||.:.|.||. |.:||||||||
 Frog   129 RSAVPPGADKKAEAGAGAATEFQFRGGFGRG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10bNP_001245758.1 S10_plectin 3..96 CDD:281497 71/94 (76%)
rps10NP_001016718.1 S10_plectin 3..97 CDD:367530 71/94 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 152 1.000 Domainoid score I4283
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134225
Inparanoid 1 1.050 199 1.000 Inparanoid score I3673
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588066at2759
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - otm47789
Panther 1 1.100 - - LDO PTHR12146
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1228
SonicParanoid 1 1.000 - - X688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.