DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10b and RGD1564698

DIOPT Version :9

Sequence 1:NP_001245758.1 Gene:RpS10b / 32953 FlyBaseID:FBgn0285947 Length:160 Species:Drosophila melanogaster
Sequence 2:XP_038943073.1 Gene:RGD1564698 / 497882 RGDID:1564698 Length:165 Species:Rattus norvegicus


Alignment Length:162 Identity:106/162 - (65%)
Similarity:122/162 - (75%) Gaps:8/162 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPEL--ESIPNLHVIKAMQSLHSRGLVKEQFAWR 63
            |.|||.:|:||||.||||||:|||||.|..|||||  :::|||||:||:|||.|||.||||||||
  Rat     1 MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAVQSLKSRGYVKEQFAWR 65

  Fly    64 HYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAVGGPRGPGDASKT-GE-DRSAY 126
            |:|||||||||:.||.||||||||||:||:| :|.||.||||.  ||.|...|..| || ||..|
  Rat    66 HFYWYLTNEGIQYLRDYLHLPPEIVPATLRR-SRPETGRPRPK--GPEGERPARFTRGEADRDTY 127

  Fly   127 RRAPGGSGVDKKGDVGPG-AGEVEFRGGFGRG 157
            ||:....|.|||.:.|.| |.|.:||||||.|
  Rat   128 RRSVVPPGADKKAEAGAGSATEFQFRGGFGHG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10bNP_001245758.1 S10_plectin 3..96 CDD:281497 71/94 (76%)
RGD1564698XP_038943073.1 S10_plectin 3..97 CDD:397530 71/94 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12146
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.