DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10b and RpS10a

DIOPT Version :9

Sequence 1:NP_001245758.1 Gene:RpS10b / 32953 FlyBaseID:FBgn0285947 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_651576.1 Gene:RpS10a / 43321 FlyBaseID:FBgn0027494 Length:163 Species:Drosophila melanogaster


Alignment Length:163 Identity:120/163 - (73%)
Similarity:130/163 - (79%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQFAWRHY 65
            ||:|||:|||||||||||||:|||||...|||.||:.||||.|||.||||:|||.|||||||||:
  Fly     1 MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLNSRGWVKEQFAWRHF 65

  Fly    66 YWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAVGGPRGP----GDASKTGEDRSAY 126
            ||.||||||||||.|||||||||||||.:..||..||||   |||.||    |.||||.:|||.|
  Fly    66 YWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPR---GGPGGPGGGFGGASKTDDDRSNY 127

  Fly   127 RRAPGGSGVDKKGDVGPGAGEVEFRGGFGRGSR 159
            ||.||..|:|||||||.|.|.||:||||||.||
  Fly   128 RRGPGAYGMDKKGDVGAGTGRVEYRGGFGRASR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10bNP_001245758.1 S10_plectin 3..96 CDD:281497 74/92 (80%)
RpS10aNP_651576.1 S10_plectin 3..96 CDD:281497 74/92 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444632
Domainoid 1 1.000 122 1.000 Domainoid score I1845
eggNOG 1 0.900 - - E1_COG5045
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1727
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D122401at33392
OrthoFinder 1 1.000 - - FOG0001119
OrthoInspector 1 1.000 - - otm26434
orthoMCL 1 0.900 - - OOG6_101133
Panther 1 1.100 - - P PTHR12146
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1228
SonicParanoid 1 1.000 - - X688
1211.830

Return to query results.
Submit another query.