Sequence 1: | NP_001245758.1 | Gene: | RpS10b / 32953 | FlyBaseID: | FBgn0285947 | Length: | 160 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157012.1 | Gene: | Plec / 18810 | MGIID: | 1277961 | Length: | 4691 | Species: | Mus musculus |
Alignment Length: | 148 | Identity: | 74/148 - (50%) |
---|---|---|---|
Similarity: | 90/148 - (60%) | Gaps: | 24/148 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQK-HPELESIPNLHVIKAMQSLHSRGLVKEQFAWRH 64
Fly 65 YYWYLTNEGIEELRSYLHLPPEIVPSTLKR---------PARSETVRPRPAVGGPRGP-GDASKT 119
Fly 120 G---------EDRSAYRR 128 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5045 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |