DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS10b and RPS10-NUDT3

DIOPT Version :9

Sequence 1:NP_001245758.1 Gene:RpS10b / 32953 FlyBaseID:FBgn0285947 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001189399.1 Gene:RPS10-NUDT3 / 100529239 HGNCID:49181 Length:291 Species:Homo sapiens


Alignment Length:154 Identity:97/154 - (62%)
Similarity:115/154 - (74%) Gaps:6/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPEL--ESIPNLHVIKAMQSLHSRGLVKEQFAWR 63
            |.|||.:|:||||.||||||:|||||.|..|||||  :::|||||:||||||.|||.||||||||
Human     1 MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWR 65

  Fly    64 HYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRP-AVGGPRGPGDASKTGEDRSAYR 127
            |:|||||||||:.||.||||||||||:||:| :|.||.|||| .:.|.| |...::...||..||
Human    66 HFYWYLTNEGIQYLRDYLHLPPEIVPATLRR-SRPETGRPRPKGLEGER-PARLTRGEADRDTYR 128

  Fly   128 RAPGGSGVDKKGDVGPG-AGEVEF 150
            |:....|.|||.:.|.| |.|.:|
Human   129 RSAVPPGADKKAEAGAGSATEFQF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS10bNP_001245758.1 S10_plectin 3..96 CDD:281497 72/94 (77%)
RPS10-NUDT3NP_001189399.1 S10_plectin 3..97 CDD:308874 72/94 (77%)
Nudix_Hydrolase_9 153..250 CDD:240024 97/154 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134225
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101133
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.