DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14205 and CG30467

DIOPT Version :9

Sequence 1:NP_608323.1 Gene:CG14205 / 32952 FlyBaseID:FBgn0031034 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster


Alignment Length:184 Identity:43/184 - (23%)
Similarity:70/184 - (38%) Gaps:55/184 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 MERTKGKLNVSLMYLHRYLRLTPVLALAIIVYMSILPRMGDGPLYGKVNFDDYSKCKDTWYWTL- 417
            :||.:|....:.||..|:: |..|:.:..::..|.|.:..:..|           || .|..:: 
  Fly    63 LERMRGDAVGNTMYSSRFI-LKTVMRVGELLRHSTLDQQLEDDL-----------CK-VWDMSVS 114

  Fly   418 -----LYVQNYATDEICLGHSWYLAV----DMQLYIIAPILLICLYKWGKKAAAGILVAMLLLAA 473
                 |.::|.|.|.|     .|..|    |::||.|    ||           |:|..|.....
  Fly   115 PEVVTLLLENGAIDPI-----MYTLVAGCEDVRLYEI----LI-----------GLLGNMCAQVE 159

  Fly   474 CLFSIMVIGDVSLIAISEGAMEKIYFSTHTRASPYLIGI--LFGYFL-HVNRGK 524
            |         ..::|.....:|.::..|:...:..||.:  ||.|.: ||..||
  Fly   160 C---------AEILACDRYTLETLFKMTYCMDTAMLIQLMRLFQYIMAHVLSGK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14205NP_608323.1 NRF 102..212 CDD:214781
OafA 269..667 CDD:224748 43/184 (23%)
Acyl_transf_3 282..660 CDD:280013 43/184 (23%)
CG30467NP_611044.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.