DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14205 and oac-45

DIOPT Version :9

Sequence 1:NP_608323.1 Gene:CG14205 / 32952 FlyBaseID:FBgn0031034 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_493127.1 Gene:oac-45 / 188335 WormBaseID:WBGene00011656 Length:663 Species:Caenorhabditis elegans


Alignment Length:372 Identity:80/372 - (21%)
Similarity:140/372 - (37%) Gaps:113/372 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 LHGIRVLSFIWVVYGHIYLVSFFGPNMNLVKLDTWRRSPYSMLVQHAAYSVDTFFFLSGLLMVVI 349
            |..:|.|:.:.|:..|.|...|  ||..|                    .||.||.|||.||.::
 Worm    12 LQAVRGLAILSVLGFHFYPNQF--PNGYL--------------------GVDQFFVLSGFLMCML 54

  Fly   350 ALRAMERTKGKLNVSLMYLHRYL----RLTPVLALAIIVYM-----------------SILPRMG 393
                :.:| ..:::..::||.|.    |:.|:...||.:.:                 |.|..:.
 Worm    55 ----LSKT-SNMSIPAVFLHFYTRRLKRILPMYFFAIFLALIALYTAFSVTNVLQNQYSALRALF 114

  Fly   394 DGPLYGKVNFDDYSKCKDTWYWTLLYVQNYATDEICLGHSWYLAVDMQLYIIAPILLICLYKWGK 458
            ......|..|:||.:..|           .|.|  ...|:|.|:|::|.|:|.|::.:.......
 Worm   115 FTSNRKKTGFEDYFEMLD-----------LAVD--IFTHTWSLSVEVQFYLIVPVVFMIGDVLSG 166

  Fly   459 KAAAGILVAMLLLAACLFSIMVIGDVSLIAISEGAMEKIYFSTHTRASPYLIGILFGYFLHV--- 520
            ....|...| |.|::.::.::...|||            :.|...|:..:|||::    :|:   
 Worm   167 NKQLGYYYA-LCLSSLIYYLVSPPDVS------------FNSVFARSWQFLIGMV----VHLKQR 214

  Fly   521 -------NRGKSFKL------SPITVVLGWLTSLALLFSCLFAVYGYAADAEIPPIVEEAFYLTF 572
                   |..:|.||      ..|:.: .|:....:|.....|.:.|    |:|..:....:..|
 Worm   215 RESSIPTNEPESEKLLENVSGEDISSI-AWVRYSFILPMISLAFFKY----ELPSTLMRLIFTIF 274

  Fly   573 TRIAWPLGLCWVVFACMHGYGGLANSFLSSPLWQPLSKLSYSAYIFH 619
            |.       |:::::....|  |.|.||:.     :..:||:.|:.|
 Worm   275 TG-------CFILYSVDDDY--LENRFLTY-----IGDISYTLYLVH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14205NP_608323.1 NRF 102..212 CDD:214781
OafA 269..667 CDD:224748 80/372 (22%)
Acyl_transf_3 282..660 CDD:280013 80/372 (22%)
oac-45NP_493127.1 OafA 1..349 CDD:224748 80/372 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.