DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14205 and oac-37

DIOPT Version :9

Sequence 1:NP_608323.1 Gene:CG14205 / 32952 FlyBaseID:FBgn0031034 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_502710.2 Gene:oac-37 / 186738 WormBaseID:WBGene00010391 Length:659 Species:Caenorhabditis elegans


Alignment Length:422 Identity:81/422 - (19%)
Similarity:141/422 - (33%) Gaps:134/422 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 IDCLHGIRVLSFIWVVYGHIYLVSFFGPNMNLVKLDTWRRSPYSMLVQHAAYSVDTFFFLSGLLM 346
            |.||.|:.:| |:::.  |::                    |::.:  :....||.||.:||.||
 Worm     5 IQCLRGLAIL-FVFLF--HLF--------------------PFTFV--NGYLGVDIFFVISGYLM 44

  Fly   347 VVIALRAMERTKGKL----NVSLMYLHRYLRLTPVLALAIIV------------YMSILPRMGDG 395
                  |...|..|:    ::...|..|:.|:.|:..|.|.|            :..:..|...|
 Worm    45 ------ARNLTHSKIQNVWDIFKFYYRRFRRILPLYYLFIPVTLVFVHLFLGEFWWGVNRRYSVG 103

  Fly   396 PLY---GKVNFDDYSKCKDTWYWTLLYVQNYATDEICLG---HSWYLAVDMQLYIIAPILLICLY 454
            ..:   .:|...|..:          |...|..|...:.   |:|.|.|:||.|::.|.::..|.
 Worm   104 AFFLVSNQVFIHDAHQ----------YFHQYLADGTSINAFIHTWSLGVEMQFYLLVPFIMFGLQ 158

  Fly   455 KWGKKAAAGILVAMLLLAACLFSIMVIGDVSLIAISEGAMEKIYFSTHTRASPYLIGILFGYFLH 519
                     .|.:.||....:.....||..:.:.|:........|....:.|.....:.:..|..
 Worm   159 ---------FLNSPLLKLIAVILTTFIGMWAFLLINAQFSFNFMFLRLWQFSAGFTALFWRDFEK 214

  Fly   520 VNRGKSFKLSPITVVLGW---------------LTSLALLFSCLFAVYGYAADAEI---PPIVEE 566
            ..:.||      |:.:|.               :.::|:||.|:..    |...||   |.|...
 Worm   215 CEKAKS------TMKIGQEPSSTYQFLRKDDVAICTIAILFLCILP----AKLDEIYLRPLITLT 269

  Fly   567 AFYLTFTRIAWPLGLCWVVFACMHGYGGLANSFLSSPLWQPLSKLSYSAYIFHMFMESLNAGITR 631
            |.||.:...:          :|         ..|.|...:.:..:||..|:.|.          .
 Worm   270 AAYLFYLEDS----------SC---------KLLRSTFLKYMGDISYVLYLVHW----------P 305

  Fly   632 TNTYFSDYQVMLRFWCDFGFTVLLAFAVYILI 663
            ..|:|....|....:|     ::|.|.:.|::
 Worm   306 VITFFKSTTVTSNIFC-----IVLTFIITIIV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14205NP_608323.1 NRF 102..212 CDD:214781
OafA 269..667 CDD:224748 81/422 (19%)
Acyl_transf_3 282..660 CDD:280013 80/417 (19%)
oac-37NP_502710.2 OafA 4..367 CDD:224748 81/422 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.