DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14205 and oac-36

DIOPT Version :9

Sequence 1:NP_608323.1 Gene:CG14205 / 32952 FlyBaseID:FBgn0031034 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_493112.1 Gene:oac-36 / 186422 WormBaseID:WBGene00010172 Length:668 Species:Caenorhabditis elegans


Alignment Length:405 Identity:85/405 - (20%)
Similarity:126/405 - (31%) Gaps:168/405 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 LHGIRVLSFIWVVYGHIYLVSFFGPNMNLVKLDTWRRSPYSMLVQHAAYSVDTFFFLSGLLMVVI 349
            |.|||.|:.:.|:..|.|...|  ||..|                    .||.||.|||.||.::
 Worm     7 LQGIRGLAILVVLGFHFYPDIF--PNGYL--------------------GVDQFFVLSGFLMCML 49

  Fly   350 ALRAMERTKGKLN-VSLMYLHRYLRLTPVLALAI--------------------------IVYMS 387
            ..||  .||.... |...|..|..|:.|:..|.|                          :|:||
 Worm    50 LKRA--ETKPFFTVVCTFYTRRLKRILPLYFLVILISTICLYNFFPETAIETNKESANRALVFMS 112

  Fly   388 ILPRMGDGPLYGKVNFDDYSKCKDTWYWTLLYVQNYATDEICLGHSWYLAVDMQLYIIAPILLIC 452
            ..|         |...:||           ..:.:.|.|  ...|:|.|:|::|.|:|.|.:.:.
 Worm   113 NRP---------KTEQEDY-----------FQMLSIAID--IFTHTWSLSVEVQFYLIVPFIFLM 155

  Fly   453 LYKWGKKAAAGILVAMLLLAACLFSIMVIGDVSLIAISEGAMEKIYFSTHTRASPYLIGIL-FGY 516
            ..|                                      .|.:.:.|:.     |:||| |||
 Worm   156 ASK--------------------------------------SETLQYPTYG-----LLGILSFGY 177

  Fly   517 FLHVNRGKSFKLSPITVVLG------WLTSLALLFSCLFAVYGYAADAEIPP-----------IV 564
                     |.:||..|...      |...:.::...|.|......|::|..           :|
 Worm   178 ---------FAISPTNVAFNSVLARIWQFLIGMVVYLLGASSNKLKDSKINATSLRSEVNYKLLV 233

  Fly   565 EEAFYLTFTRIAWPLGLCWVVFACM--------------------HGYGGLA-----NSFLSSPL 604
            |......|...::.:...:::.|.:                    .|.|.|.     ||.||:.|
 Worm   234 EHEEISKFNHSSYSMTAAYILLASLIAITASPFVLPATITRLTATVGTGLLMLLSENNSVLSNKL 298

  Fly   605 WQPLSKLSYSAYIFH 619
            ...:..:|||.|:.|
 Worm   299 LTYIGDISYSLYLVH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14205NP_608323.1 NRF 102..212 CDD:214781
OafA 269..667 CDD:224748 85/405 (21%)
Acyl_transf_3 282..660 CDD:280013 85/405 (21%)
oac-36NP_493112.1 OafA 1..355 CDD:224748 85/405 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.