DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14204 and CG30467

DIOPT Version :9

Sequence 1:NP_001259710.1 Gene:CG14204 / 32950 FlyBaseID:FBgn0031032 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster


Alignment Length:216 Identity:43/216 - (19%)
Similarity:65/216 - (30%) Gaps:73/216 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 HCLNGMRCMSLIWVILSHEYIINMKGPAINPADNLRWATQL-FSSFILYGTLSVDTFFFISGLLL 344
            |.|:|....::.|.|....:        .|.|.||....|| .|..:|...|..      :..:|
  Fly   199 HVLSGKEKFAVNWYICFAAF--------ENSAQNLGRILQLSVSDELLVAALKA------TNAVL 249

  Fly   345 VSIGLRSIEKNKGKLNVPLMYLHRYLRLTPIVAVAIL---------AFYKM-------------- 386
            .|..|...|.....||           |.|...|.::         ||.::              
  Fly   250 ASCALVEEENANSTLN-----------LKPFAEVFLVPELCEGVNSAFLRLMRDDQTKLTDEEAG 303

  Fly   387 -------IPLIADGPMYDDIGFFDYSGCKMTWYWTLLYVQNY--------------ATSDVCVPH 430
                   :|...|.....|:| :|..|.|:|  ..:..:|.|              |:.||..|.
  Fly   304 EDNEDAEVPAAHDSDEDADVG-YDSCGPKIT--CDVEIIQTYLNICTILVQLPEAQASMDVYAPS 365

  Fly   431 TWYLAVDMQLYILSPILLIAL 451
            .......:..::..|:.||.|
  Fly   366 IVSCLARILQFLQQPLQLIPL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14204NP_001259710.1 NRF 94..209 CDD:214781
Acyl_transf_3 280..664 CDD:280013 43/216 (20%)
OafA 283..687 CDD:224748 42/214 (20%)
CG30467NP_611044.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.