DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD17B4 and euc

DIOPT Version :10

Sequence 1:NP_001186220.1 Gene:HSD17B4 / 3295 HGNCID:5213 Length:761 Species:Homo sapiens
Sequence 2:NP_001247188.1 Gene:euc / 42271 FlyBaseID:FBgn0038665 Length:112 Species:Drosophila melanogaster


Alignment Length:75 Identity:23/75 - (30%)
Similarity:39/75 - (52%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   647 LQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKG-GNIGAKWTIDLKSGSGKVYQGPAKGAAD 710
            ::|..:.|:|..:||:..|.....|| .|:::.|.. ||:......|.|:..  :|:|.|. :.|
  Fly     1 MKSDEIIEKIRNKLKESDPARRTVVN-TFQFNFTDADGNLIKSMVFDFKALD--IYEGSAT-SVD 61

Human   711 TTIILSDEDF 720
            ..:.:|||||
  Fly    62 AQVTISDEDF 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD17B4NP_001186220.1 hydroxyacyl-CoA-like_DH_SDR_c-like 61..279 CDD:187611
PLN02864 353..630 CDD:178455
SCP2 653..756 CDD:460423 22/69 (32%)
eucNP_001247188.1 SCP2 12..95 CDD:460423 20/64 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.