DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD17B4 and CG14881

DIOPT Version :10

Sequence 1:NP_001186220.1 Gene:HSD17B4 / 3295 HGNCID:5213 Length:761 Species:Homo sapiens
Sequence 2:NP_732137.1 Gene:CG14881 / 41990 FlyBaseID:FBgn0038425 Length:286 Species:Drosophila melanogaster


Alignment Length:194 Identity:40/194 - (20%)
Similarity:68/194 - (35%) Gaps:66/194 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   552 DKP--ILHGLCTF----GFSAR------------RVLQQFA----DNDVSRFKAIKARFAKPVYP 594
            |.|  :||.|..|    .|..|            |.:|::.    |..:...||:|         
  Fly   115 DHPEIVLHSLALFYQLLEFGERTERDLLLSPAVLRTVQEWRVKAHDERILSSKAVK--------- 170

Human   595 GQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSE----GGKLQSTFVFEE 655
                |.::.|..::...:...|.|||    :.|:.       |.:||:|    .|.|.:..|...
  Fly   171 ----QVQVVKRFSQSDLEQFAQFTGD----HNYIH-------SLETPTEERRVHGALLNAVVAGI 220

Human   656 IGRRLKDIGPEVVK-----------KVNAVFEWHITKGGNIGAKWTI--DLKSGSGKVYQGPAK 706
            :|.:|...|..|::           :.:.|....:.:...|.   |:  |::.....|:.|.||
  Fly   221 MGTQLPGPGTVVLEQNFKFLKPCRIETDTVVTVRLLQSRKIS---TVEYDIRQNDEVVFAGSAK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD17B4NP_001186220.1 hydroxyacyl-CoA-like_DH_SDR_c-like 61..279 CDD:187611
PLN02864 353..630 CDD:178455 21/99 (21%)
SCP2 653..756 CDD:460423 12/67 (18%)
CG14881NP_732137.1 R_hydratase 171..283 CDD:239533 26/125 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.