DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and CLA4

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_014101.1 Gene:CLA4 / 855418 SGDID:S000005242 Length:842 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:119/340 - (35%)
Similarity:168/340 - (49%) Gaps:60/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ARPGSLKDPE--------IADLFNK-------HDPEKIFEDLREIGHGSFGAVYYA-RCNLTREI 52
            |:||.:..|:        .|::.:|       .||.:.|:.:.:.|.|:.|:||.| |.::..|.
Yeast   508 AQPGGVAKPKKPARPTMSTAEIMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTES 572

  Fly    53 ------------------VAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLR-ES 98
                              ||||:|..:   .|.:.:.|:.||..::...|.|.:.:...||| :.
Yeast   573 NMIELINNDIDEPHVGDKVAIKQMVLS---KQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDD 634

  Fly    99 TAWLVMEYCV-GSASDIIE-------VHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGN 155
            ..|:|||:.. ||.:||||       .| .||.|.:||.|......||.:||....||||||:.|
Yeast   635 DLWVVMEFMEGGSLTDIIENSPTNDNSH-SPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDN 698

  Fly   156 ILLTDNGVVKLADFGSAAIKCPANS----FVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIE 216
            :||.....||:.|||..|......|    .|||||||||||:   .:.:||.|:|||||||..||
Yeast   699 VLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVV---KQREYDEKIDVWSLGIMTIE 760

  Fly   217 LAERKPPYFNMNAMSALYHIAQNESPTL--PKNDWSDAFCSFVELCLKKMPAERPSSAKLLTHAY 279
            :.|.:|||.|.:.:.|||.||.|.:|.|  |:: .|.....|:.:||......|.|:.:||.|.:
Yeast   761 MLEGEPPYLNEDPLKALYLIATNGTPKLKHPES-LSLEIKRFLSVCLCVDVRYRASTEELLHHGF 824

  Fly   280 VTR---PRSDTVLLE 291
            ...   |:..|.|||
Yeast   825 FNMACDPKDLTSLLE 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 106/290 (37%)
S_TKc 27..280 CDD:214567 106/286 (37%)
CLA4NP_014101.1 PH_Cla4_Ste20 62..174 CDD:270097
PBD 183..241 CDD:395634
STKc_PAK 546..826 CDD:270789 106/287 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.