DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and AT1G67890

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_564913.1 Gene:AT1G67890 / 843117 AraportID:AT1G67890 Length:765 Species:Arabidopsis thaliana


Alignment Length:272 Identity:88/272 - (32%)
Similarity:136/272 - (50%) Gaps:33/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPEKIFEDL---REIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDIL----KEIRFL 79
            |.|.::|||   .:||.||.|.||:..  .....||:|..|     .||..::|:    :|:..:
plant   479 DYEILWEDLTIGEQIGQGSCGTVYHGL--WFGSDVAVKVFS-----KQEYSEEIITSFKQEVSLM 536

  Fly    80 RQLNHPNTIEYKGCYLRESTAWLVMEYCV-GSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLH- 142
            ::|.|||.:.:.|.........:|.|:.. ||...:::.:|..|.......:...:..|::||| 
plant   537 KRLRHPNVLLFMGAVASPQRLCIVTEFLPRGSLFRLLQRNKSKLDLRRRIHMASDIARGMNYLHH 601

  Fly   143 -SLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANSFV-----GTPYWMAPEVIL--AMDEG 199
             |...||||:|:.|:|:..|..||:||||.:.||  ..:::     |||.||||||:.  |.|| 
plant   602 CSPPIIHRDLKSSNLLVDRNWTVKVADFGLSRIK--HETYLTTNGRGTPQWMAPEVLRNEAADE- 663

  Fly   200 QYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIA-QNESPTLPKNDWSDAFCSFVELCLKK 263
                |.||:|.|:...||...|.|:.|:|||..:..:. .|:...:|| |....:.:.:|.|...
plant   664 ----KSDVYSFGVVLWELVTEKIPWENLNAMQVIGAVGFMNQRLEVPK-DVDPQWIALMESCWHS 723

  Fly   264 MPAERPSSAKLL 275
            .|..|||..:|:
plant   724 EPQCRPSFQELM 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 86/269 (32%)
S_TKc 27..280 CDD:214567 86/267 (32%)
AT1G67890NP_564913.1 PAS 101..211 CDD:395786
STKc_MAP3K-like 493..738 CDD:270901 83/258 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.