DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and STK24

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_016876283.1 Gene:STK24 / 8428 HGNCID:11403 Length:517 Species:Homo sapiens


Alignment Length:334 Identity:137/334 - (41%)
Similarity:197/334 - (58%) Gaps:30/334 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNH 84
            |.|||::|..|.:||.||||.|:....|.|:::||||.:..  ::::::.:||.:||..|.|.:.
Human   103 KADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDL--EEAEDEIEDIQQEITVLSQCDS 165

  Fly    85 PNTIEYKGCYLRESTAWLVMEYC-VGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIH 148
            |...:|.|.||:::..|::|||. .|||.|::|  ..||.|.:||.|...:|.||.||||..:||
Human   166 PYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLE--PGPLDETQIATILREILKGLDYLHSEKKIH 228

  Fly   149 RDIKAGNILLTDNGVVKLADFGSAA----IKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWS 209
            |||||.|:||:::|.|||||||.|.    .:...|:|||||:|||||||   .:..||.|.|:||
Human   229 RDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI---KQSAYDSKADIWS 290

  Fly   210 LGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKMPAERPSSAKL 274
            ||||.||||..:||:..::.|..|:.|.:|..|||..| :|.....|||.||.|.|:.||::.:|
Human   291 LGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGN-YSKPLKEFVEACLNKEPSFRPTAKEL 354

  Fly   275 LTHAYVTR-PRSDTVLLELIARTKSAVRELDNLNYRKMKKILMVDTCETESAVGDTDDQQDDHAG 338
            |.|.::.| .:..:.|.|||.|            |::.|    .:....:|:..|:|.:.|..|.
Human   355 LKHKFILRNAKKTSYLTELIDR------------YKRWK----AEQSHDDSSSEDSDAETDGQAS 403

  Fly   339 GDSSKSNSI 347
            |.|...:.|
Human   404 GGSDSGDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 117/261 (45%)
S_TKc 27..280 CDD:214567 117/257 (46%)
STK24XP_016876283.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.