DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and WEE1

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_171796.1 Gene:WEE1 / 839453 AraportID:AT1G02970 Length:500 Species:Arabidopsis thaliana


Alignment Length:275 Identity:79/275 - (28%)
Similarity:117/275 - (42%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FEDLREIGHGSFGAVYYARCNLTREIVAIKKMS---YTGKQSQEKW------QDILKEIRFLRQL 82
            |.::|:||.|.|..|:          ..:|:|.   |..|.|..|.      :..:.|::.|..|
plant   249 FHEIRQIGAGHFSRVF----------KVLKRMDGCLYAVKHSTRKLYLDSERRKAMMEVQALAAL 303

  Fly    83 N-HPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGR 146
            . |.|.:.|...:......::.:|.|..|.|.:.:.....:.|.||..|...:...|.::|..|.
plant   304 GFHENIVGYYSSWFENEQLYIQLELCDHSLSALPKKSSLKVSEREILVIMHQIAKALHFVHEKGI 368

  Fly   147 IHRDIKAGNILLTDNGVVKLADFGSAA---IKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVW 208
            .|.|:|..||.: .|||.||.|||.|.   ...|...  |...:| |:.||..|....| |||::
plant   369 AHLDVKPDNIYI-KNGVCKLGDFGCATRLDKSLPVEE--GDARYM-PQEILNEDYEHLD-KVDIF 428

  Fly   209 SLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKM----PAERP 269
            |||:|..||.:..|...:.|..   .:|.:.:.|.||.:...      ::..||.|    |..||
plant   429 SLGVTVYELIKGSPLTESRNQS---LNIKEGKLPLLPGHSLQ------LQQLLKTMMDRDPKRRP 484

  Fly   270 SSAKLLTHAYVTRPR 284
            |:.:||.|....|.|
plant   485 SARELLDHPMFDRIR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 77/271 (28%)
S_TKc 27..280 CDD:214567 77/269 (29%)
WEE1NP_171796.1 PKc_Wee1_like 248..493 CDD:270899 76/267 (28%)
S_TKc 249..495 CDD:214567 77/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.