DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and AT1G18160

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_173254.2 Gene:AT1G18160 / 838395 AraportID:AT1G18160 Length:992 Species:Arabidopsis thaliana


Alignment Length:347 Identity:96/347 - (27%)
Similarity:155/347 - (44%) Gaps:63/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKDPEIADLFNKHDP--------EKIFEDL---REIGHGSFGAVYYARCNLTREIVAIKK---MS 59
            :.|..|.:..:|.|.        |.::|::   ..||.||:|.||  |.:.....||:||   ..
plant   686 ISDRSIGNESSKSDAAIDDVAECEILWEEITVAERIGLGSYGEVY--RGDWHGTAVAVKKFIDQD 748

  Fly    60 YTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCV-GSASDIIEVHKKPLH 123
            .||    |..::...|:|.:|:|.|||.:.:.|...|.....:|.|:.. ||...:|......|.
plant   749 ITG----EALEEFRSEVRMMRRLRHPNIVLFMGAVTRPPNLSIVTEFLPRGSLYRLIHRPNNQLD 809

  Fly   124 EDEIAAICLGVLSGLSYLHSLGR--IHRDIKAGNILLTDNGVVKLADFGSAAIK----CPANSFV 182
            |.:...:.|....|::||||...  :|||:|:.|:|:..|.|||:.|||.:.:|    ..:.|..
plant   810 ERKRLRMALDAARGMNYLHSCNPVIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKVSTYLSSKSTA 874

  Fly   183 GTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIA-QNESPTLPK 246
            ||..||||||   :.....|.|.||:|.|:...||...:.|:..||.|..:..:. |:....:|:
plant   875 GTAEWMAPEV---LRNEPADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGFQHRRLDIPE 936

  Fly   247 NDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVRELDNLNYRKM 311
                     ||:          |..|.::...:.|.||......|:          :|:|  :::
plant   937 ---------FVD----------PGIADIIRKCWQTDPRLRPSFGEI----------MDSL--KQL 970

  Fly   312 KKILMVDTCETESAVGDTDDQQ 333
            :|.:......:.||: .||:|:
plant   971 QKPIQRAAVPSSSAL-TTDEQE 991

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 79/270 (29%)
S_TKc 27..280 CDD:214567 79/266 (30%)
AT1G18160NP_173254.2 EDR1 154..359 CDD:373038
STKc_MAP3K-like 721..967 CDD:270901 83/283 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.