DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and VIK

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_172853.1 Gene:VIK / 837960 AraportID:AT1G14000 Length:438 Species:Arabidopsis thaliana


Alignment Length:272 Identity:75/272 - (27%)
Similarity:119/272 - (43%) Gaps:28/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPEKI-FEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHP 85
            :|.:: |.:...||.||||.:..|....|.  ||:|::..:....:...||...|:..|.:|.||
plant   156 EPAELDFSNAAMIGKGSFGEIVKAYWRGTP--VAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHP 218

  Fly    86 NTIEYKGCYLRESTAWLVMEYCVGSASDIIEVH-----KKPLHEDEIAAICLGVLSGLSYLHSLG 145
            |.:::.|.........|:.||..|.     ::|     |..|.........|.:..|::|||:..
plant   219 NIVQFLGAVTERKPLMLITEYLRGG-----DLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEP 278

  Fly   146 R--IHRDIKAGNILLTDNGV--VKLADFGSAAIKCPANSF--------VGTPYWMAPEVILAMDE 198
            .  ||||:|..|:||.::..  :|:.|||.:.:....||.        .|:..:|||||   ...
plant   279 NVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEV---FKH 340

  Fly   199 GQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKK 263
            .:||.||||:|..:...|:.|.:||:.|.....|..|::....||......:......:..|...
plant   341 RRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDA 405

  Fly   264 MPAERPSSAKLL 275
            ...:|||...:|
plant   406 DMNQRPSFLDIL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 74/269 (28%)
S_TKc 27..280 CDD:214567 74/266 (28%)
VIKNP_172853.1 ANK repeat 36..68 CDD:293786
PTZ00322 45..>126 CDD:140343
ANK repeat 70..101 CDD:293786
ANK repeat 103..127 CDD:293786
STKc_MAP3K-like 168..420 CDD:270901 73/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.