DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and AT5G57610

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_200569.1 Gene:AT5G57610 / 835865 AraportID:AT5G57610 Length:1054 Species:Arabidopsis thaliana


Alignment Length:337 Identity:94/337 - (27%)
Similarity:148/337 - (43%) Gaps:68/337 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ARPGSLKD---PEIADLFNKH-----DPE-----------KI---------------------FE 28
            |.|...||   ||:.:..::|     :||           ||                     .|
plant   718 AHPEEAKDQVRPELVENESEHMNAQDEPEIDSDSDNPNNFKIEQTKAEAEAKSRGLQSIRNDDLE 782

  Fly    29 DLREIGHGSFGAVYYARCNLTREIVAIKKMS---YTGKQSQEK--WQDILKEIRFLRQLNHPNTI 88
            ::||:|||::|:||:.:..  ...||||::.   :.||.|:.:  .:|..||...|..|:|||.:
plant   783 EIRELGHGTYGSVYHGKWK--GSDVAIKRIKASCFAGKPSERERLIEDFWKEALLLSSLHHPNVV 845

  Fly    89 EYKGCYLR---ESTAWLVMEYCV-GSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHR 149
            .:.| .:|   :.:...|.|:.| ||....::...:.:...:...|.:....|:.|||....:|.
plant   846 SFYG-IVRDGPDGSLATVAEFMVNGSLKQFLQKKDRTIDRRKRLIIAMDTAFGMEYLHGKNIVHF 909

  Fly   150 DIKAGNILLT----DNGVVKLADFGSAAIK---CPANSFVGTPYWMAPEVILAMDEGQYDGKVDV 207
            |:|..|:|:.    ...:.|:.|.|.:.:|   ..:....||..||||| :|:........|:||
plant   910 DLKCENLLVNMRDPQRPICKIGDLGLSKVKQKTLVSGGVRGTLPWMAPE-LLSGKSNMVSEKIDV 973

  Fly   208 WSLGITCIELAERKPPYFNMNAMSALYHIAQNE-SPTLPKNDWSD-AFCSFVELCLKKMPAERPS 270
            :|.||...||...:.||.:|:..|.:..|..|. .|.:|:  |.| .:...:|.|....|.||||
plant   974 YSFGIVMWELLTGEEPYADMHCASIIGGIVNNALRPKIPQ--WCDPEWKGLMESCWTSEPTERPS 1036

  Fly   271 ----SAKLLTHA 278
                |.||.|.|
plant  1037 FTEISQKLRTMA 1048

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 85/297 (29%)
S_TKc 27..280 CDD:214567 83/274 (30%)
AT5G57610NP_200569.1 PB1_UP2 27..123 CDD:99731
STKc_MAP3K-like 787..1044 CDD:270901 76/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.