DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and WNK8

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_568599.1 Gene:WNK8 / 834204 AraportID:AT5G41990 Length:563 Species:Arabidopsis thaliana


Alignment Length:349 Identity:99/349 - (28%)
Similarity:164/349 - (46%) Gaps:50/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GSLKDPEIADLFNKHDPEK---IFEDLREIGHGSFGAVYYA-----RCNLTREIVAIKKMSYTGK 63
            |.:...|.|| |.:.||..   .::|:  :|.|:|..||.|     ...:...:|:|:.:    .
plant     9 GQISSMEEAD-FAEKDPSGRYIRYDDV--LGRGAFKTVYKAFDEVDGIEVAWNLVSIEDV----M 66

  Fly    64 QSQEKWQDILKEIRFLRQLNHPNTIE--YKGCYLRESTAWLVME-YCVGSASDIIEVHKKPLHED 125
            |...:.:.:..|:..|:.|.|.|.|:  |.....:..|..::.| :..||    :.|::|...:.
plant    67 QMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGS----LRVYRKKHRKV 127

  Fly   126 EIAAI---CLGVLSGLSYLHSLGR--IHRDIKAGNILLTDN-GVVKLADFGSAAI--KCPANSFV 182
            :..||   ...:|.||:||||...  ||||:|..||.:..| |.||:.|.|.|.:  :..|.|.:
plant   128 DPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVI 192

  Fly   183 GTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALY-HIAQNESP-TLP 245
            |||.:||||:.    |.:|:..||::|.|:..:|:...:.||......:.:| .:..|..| :|.
plant   193 GTPEFMAPELY----EEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLG 253

  Fly   246 KNDWSDAFCSFVELCLKKMPA-ERPSSAKLLTHAYVTRP-RSDTVLLELIARTKSAVR--ELDNL 306
            |.| ......|:|.||  :|| .||::.:|....::.|. ..|:.||...:.:...||  :|::|
plant   254 KVD-DPQVRQFIEKCL--LPASSRPTALELSKDPFLARDGGKDSALLASSSTSSKYVRPPQLEHL 315

  Fly   307 NYRKMKKILMVDTCETESAVGDTD 330
            .       :.||..|.:|...:.|
plant   316 P-------MDVDHNENKSVSSNED 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 79/278 (28%)
S_TKc 27..280 CDD:214567 79/271 (29%)
WNK8NP_568599.1 STKc_WNK 27..286 CDD:270885 79/275 (29%)
S_TKc 33..286 CDD:214567 79/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.